HORDB

ID: hor006828
Uniprot ID: O09037??28-175)
Protein name: Regenerating islet-derived protein 3-alpha 16.5 kDa form
Gene name: CXCL11; ITAC, SCYB11, SCYB9B;
Organism: Mus musculus
Family: NA
Source: Animal
Expression: Small intestine and pancreas.
Disease: NA
Comments: NA
Taxonomy: Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
GO MF: GO:0005615 extracellular space
GO BP: GO:0070492 oligosaccharide binding; GO:0046872 metal ion binding; GO:0038023 signaling receptor activity; GO:0042834 peptidoglycan binding
GO CC: GO:0008284 positive regulation of cell population proliferation; GO:0006953 acute-phase response; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0045617 negative regulation of keratinocyte differentiation; GO:0043434 response to peptide hormone; GO:0010838 positive regulation of keratinocyte proliferation; GO:0090303 positive regulation of wound healing

Sequence: DFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ
Length: 148
Propeptide: MLPHLVLNSISWMLLSCLLFVFQVQGEDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ
Signal peptide: MLPHLVLNSISWMLLSCLLFVFQVQG
Modification: T1 N-acetylmethionine
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

Mass:		Formula:
Absent amino acids:		Common amino acids:
pI:		Basic residues:
Polar residues:		Hydrophobic residues:
Hydrophobicity:		Boman Index:
Half-Life:		Half-Life Yeast:
Half-Life E.Coli:		Aliphatic Index
Instability Index:		Extinction Coefficient cystines:
Absorbance 280nm: